PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID orange1.1g006986m
Common NameCISIN_1g006986mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family GRAS
Protein Properties Length: 623aa    MW: 68586.1 Da    PI: 4.9343
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
orange1.1g006986mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS343.43.9e-1052556222374
               GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkf 93 
                        +++L++cA  v+s +  +a + L rl+  +  +g+p++R+a yfteAL +rl++   +  k++++ e++    ++ + ++k++++++P+ kf
  orange1.1g006986m 255 TKALIDCACLVES-EPDKAVKSLVRLRGSVCAHGNPTERVAYYFTEALYKRLTQ---RAEKSITTLEAN---CEDCILSFKTLNDACPYSKF 339
                        689******9998.5677788899*****************************9...555555555555...999***************** PP

               GRAS  94 shltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegpp.slRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlv 182
                        ++ltaNqaIlea+e+++++Hi+Df+i qG+QW  LlqaLa+Rp g+p ++Ri g+ +p+ g   + +l +tg+rL++fA +l +++ef++ +
  orange1.1g006986m 340 AYLTANQAILEATENASHIHIVDFGIVQGIQWSFLLQALANRPTGKPvKVRISGIPAPALGksPAASLLATGDRLREFAGSLSLNLEFEP-I 430
                        *******************************************87777*********9999889999***********************.6 PP

               GRAS 183 akrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleak 274
                           + +l+ +++rv+p+Eal+Vn++lql +lld++    +   + L++ ksl+P vv+++e ea++n++ Fl+rf +al+yy+a+f+sle +
  orange1.1g006986m 431 LIPIRKLRASSFRVDPNEALVVNFMLQLNSLLDDNRLAVE---NALQMAKSLNPIVVTLAEYEANLNRTGFLARFKNALKYYTAVFESLEPN 519
                        889*****************************87766555...8************************************************ PP

               GRAS 275 lpreseerikvErellgreivnvvacegae.rrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslv.lgWk 363
                        + ++s+er  vEr++lg++i n++a e++  +rer e  e+Wr  +e++ F+ +p+s++a +qa+ ll +++ s  ++++++++ l+ l Wk
  orange1.1g006986m 520 MTTDSDERFQVERQILGPRIANLLAPEKQGaKRERVEDIENWRIFMENSDFEGIPFSHYALSQAEILLWNYNySPLFTLNQSHDNLLtLSWK 611
                        *************************9998769****************************************999****987666555**** PP

               GRAS 364 drpLvsvSaWr 374
                        + pL++vS+Wr
  orange1.1g006986m 612 KVPLLTVSSWR 622
                        **********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098555.98228600IPR005202Transcription factor GRAS
PfamPF035141.3E-102255622IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 623 aa     Download sequence    Send to blast
MAYMCADSGN LMAVAQQVIK QKQEQEKQQQ QQQQQQHQQN SDQPQQQFFG LNPYSLNPWT  60
SSSQHSISVS NSPNFGYGFT GPGFPDPLDT GESGFPFPQI DHHSTSGGFR FSDFGGGPGG  120
EFDSDEWMES LMNTAHSTDS SNLPPACDAW QNNASDFGLY ATDPFTSCPS QLGSPTSELN  180
RVVFADSQKT ILPAWPPSPP PPLVPPESAV KELAKQVSPS PSPSPSPSRV PPPNDAVGAS  240
TSTGFAEAEL AQPLTKALID CACLVESEPD KAVKSLVRLR GSVCAHGNPT ERVAYYFTEA  300
LYKRLTQRAE KSITTLEANC EDCILSFKTL NDACPYSKFA YLTANQAILE ATENASHIHI  360
VDFGIVQGIQ WSFLLQALAN RPTGKPVKVR ISGIPAPALG KSPAASLLAT GDRLREFAGS  420
LSLNLEFEPI LIPIRKLRAS SFRVDPNEAL VVNFMLQLNS LLDDNRLAVE NALQMAKSLN  480
PIVVTLAEYE ANLNRTGFLA RFKNALKYYT AVFESLEPNM TTDSDERFQV ERQILGPRIA  540
NLLAPEKQGA KRERVEDIEN WRIFMENSDF EGIPFSHYAL SQAEILLWNY NYSPLFTLNQ  600
SHDNLLTLSW KKVPLLTVSS WR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-1232536223375GRAS family transcription factor containing p
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Csi.9900.0flower| fruit| stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006425686.10.0hypothetical protein CICLE_v10025169mg
RefseqXP_006466786.10.0PREDICTED: scarecrow-like protein 4
RefseqXP_006466785.10.0PREDICTED: scarecrow-like protein 4
SwissprotQ9FL030.0SCL4_ARATH; Scarecrow-like protein 4
TrEMBLA0A067GVQ10.0A0A067GVQ1_CITSI; Uncharacterized protein
STRINGSolyc02g085340.1.10.0(Solanum lycopersicum)
STRINGPGSC0003DMT4000385730.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM47862752
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66770.10.0GRAS family protein